추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
SCYFFSTDTISWALSLKNCSAMGAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSFWDVGEPNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRI
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CLEC4E(26253)
일반 설명
CLEC4E (C-type lectin domain family 4, member E) belongs to C-type lectin receptors, which is a family of pattern recognition receptors. C-type lectin receptor family has more than 1000 members and includes any protein which has one or more C-type lectin-like domain (CLTD). CLEC4E, also called mincle, is a type II transmembrane protein, which is 219 aa long and has a highly conserved CLTD. CLEC4E is located on human chromosome 12 within the natural killer (NK) gene complex, which also includes BDCA-2, DCAR, DCIR, Dectin-2, and Clecsf8. CLEC4E protein has a single transmembrane domain, a short N- terminal cytoplasmic domain and a C-terminal extracellular C-type lectin carbohydrate recognition domain.
면역원
C-type lectin domain family 4, member E recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
생화학적/생리학적 작용
CLEC4E (C-type lectin domain family 4, member E) recognises the glycolipid trehalose-6,6-dimycolate (TDM, also called cord factor) present in Mycobacterium species, pathogenic fungi Malassezia spp., and spliceosome-associated protein 130 (SAP130), which is an endogenous ligand released during cell necrosis. Upon sensing damaged cells, Mincle induces activated macrophages to produce inflammatory cytokines. It plays an important role in the immunological response against Candida albicans infections in mammals. It is also responsible for the inflammation in lupus nephritis, by interacting with SAP130 present in necrotic cell debris and promoting the production of inflammatory cytokines. CLEC4E, in coordination with CLEC4D, helps to control bacterial growth and hyperinflammation in bacterial pneumonia and chronic lung diseases, by regulating phagocytosis and efferocytosis. It also has functions in or has relevance to diseases such as connective tissue disorder, rheumatic disease, arthritis, skeletal and muscular disorder etc.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST70024
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Myeloid C-type lectin receptors in pathogen recognition and host defense.
Osorio F and Reis e Sousa C
Immunity, 34(5), 651-664 (2011)
Mincle and human B cell function.
Kawata K
Journal of Autoimmunity, 39(4), 315-322 (2012)
Silencing of renal DNaseI in murine lupus nephritis imposes exposure of large chromatin fragments and activation of Toll like receptors and the Clec4e.
Thiyagarajan D
PLoS ONE, 7(3), e34080-e34080 (2012)
Antibacterial and pro-resolving mechanisms in lung diseases: role of C-type lectin receptors (INM2P.430)
Sharma J
Journal of Immunology, 192(1), 56-13 (2014)
Anton G Kutikhin et al.
Cancer management and research, 4, 39-53 (2012-03-20)
The group of pattern recognition receptors includes families of Toll-like receptors, NOD-like receptors, C-type lectin receptors, and RIG-I-like receptors. They are key sensors for a number of infectious agents, some of which are oncogenic, and they launch an immune response
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.