콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV54293

Sigma-Aldrich

Anti-FUCA1 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-α-L-Fucosidase 1, tissue

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

54 kDa

종 반응성

rat, mouse, pig, bovine, human

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... FUCA1(2517)

면역원

Synthetic peptide directed towards the N terminal region of human FUCA1

애플리케이션

Anti-FUCA1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

생화학적/생리학적 작용

FUCA1 gene encodes a lysosomal enzyme, α-L-fucosidase mapped on to chromosome 1 at position 1p34.1-1p36. α-L-fucosidase plays a crucial role in hydrolyzing the fucose-containing glycoproteins and glycolipids. Presence of α-L-fucosidase in preoperative serum serves as a prognostic indicator for hepatocellular carcinoma. Mutation in FUCA1 gene leads to fucosidosis, an autosomal recessive lysosomal storage disease.

서열

Synthetic peptide located within the following region: PSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPLYLL

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

K Wang et al.
British journal of cancer, 110(7), 1811-1819 (2014-02-27)
Preoperative alpha-L-fucosidase (AFU) has been used as a diagnostic biomarker for hepatocellular carcinoma (HCC), but its role as a prognostic predictor after partial hepatectomy has not been well defined. The study aimed to investigate the prognostic significance of preoperative serum
J K Darby et al.
American journal of human genetics, 43(5), 749-755 (1988-11-01)
Human alpha-L-fucosidase is a lysosomal enzyme responsible for hydrolysis of alpha-L-fucoside linkages in fucoglycoconjugates. A single gene, FUCA 1, located on chromosome 1p34.1-1p36.1 encodes for alpha-L-fucosidase activity. To gain insight into the nature of the molecular defects leading to fucosidosis
Chiaki Nagai-Okatani et al.
PloS one, 11(6), e0150210-e0150210 (2016-06-10)
Targeted proteomics focusing on post-translational modifications, including glycosylation, is a useful strategy for discovering novel biomarkers. To apply this strategy effectively to cardiac hypertrophy and resultant heart failure, we aimed to characterize glycosylation profiles in the left ventricle and plasma
Nobuo Tsuchida et al.
International journal of oncology, 50(6), 2043-2048 (2017-04-26)
Fucose residues of cell surface glycans, which play important roles in growth, invasion and metastasis, are added by fucosyltransferases (FUTs) and removed by α-L-fucosidases (FUCAs). By the differential display method, we isolated a 3' non-coding region of α-L-fucosidase-1 (FUCA1) (a gene
M Williamson et al.
Journal of medical genetics, 30(3), 218-223 (1993-03-01)
Fucosidosis is a rare, autosomal recessive, lysosomal storage disease, resulting from a deficiency of the enzyme alpha-fucosidase (EC 3.2.1.51). It is characterised clinically by progressive mental and motor deterioration, growth retardation, coarse facies, and often recurrent infections, but the course

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.