추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
37 kDa
종 반응성
human, rat, guinea pig, mouse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SEPT9(septin 9)
면역원
Synthetic peptide directed towards the C terminal region of human SEPT9(septin 9)
애플리케이션
Anti-SEPT9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
생화학적/생리학적 작용
Septin 9 (SEPT9; SeptD1) is a member of the septin family and is involved in cell cycle control and cytokinesis. Members of this family form complexes and filamentous structures that maintain the cytoskeleton. The septin proteins act as scaffolds to recruit proteins to specific cellular locations. Septin 9 interacts with bundle microtubules and is altered in neuralgic amyotrophy. It has been found to be hypermethylated in certain cancers.
서열
Synthetic peptide located within the following region: HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Septins.
Mathew P Estey et al.
Current biology : CB, 21(10), R384-R387 (2011-05-24)
Reinhold Wasserkort et al.
BMC cancer, 13, 398-398 (2013-08-31)
The septin 9 gene (SEPT9) codes for a GTP-binding protein associated with filamentous structures and cytoskeleton formation. SEPT9 plays a role in multiple cancers as either an oncogene or a tumor suppressor gene. Regulation of SEPT9 expression is complex and
Xiaobo Bai et al.
The Journal of cell biology, 203(6), 895-905 (2013-12-18)
Septin 9 (SEPT9) interacts with microtubules (MTs) and is mutated in hereditary neuralgic amyotrophy (HNA), an autosomal-dominant neuropathy. The mechanism of SEPT9 interaction with MTs and the molecular basis of HNA are unknown. Here, we show that the N-terminal domain
Kirstin Sandrock et al.
Biological chemistry, 392(8-9), 751-761 (2011-07-20)
Septins constitute a group of GTP binding proteins that assemble into homo- and hetero-oligomeric complexes and filaments. These higher order septin structures are thought to function like scaffolds and/or diffusion barriers serving as spatial localizers for many proteins with key
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.