추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
9 kDa
종 반응성
rat, dog, bovine, pig, horse, human, mouse
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... C3orf10(55845)
면역원
Synthetic peptide directed towards the middle region of human C3orf10
애플리케이션
Anti-C3ORF10 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
생화학적/생리학적 작용
C3ORF10 (HSPC300) is a protein associated with the organization of actin filaments and cell motility. It interacts with WAVE2 protein and affects the metastatic potential of lung squamous cell carcinoma. Loss of the actin regulation by HSPC300 confers resistance to clear cell renal cell carcinoma in Von Hippel-Lindau patients indicating its role in tumor progression.
서열
Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Xiongwei Cai et al.
Lung cancer (Amsterdam, Netherlands), 65(3), 299-305 (2009-07-07)
The small protein, HSPC300 (haematopoietic stem/progenitor cell protein 300), is associated with reorganization of actin filaments and cell movement, but its activity has not been reported in human cancer cells. Here, we investigated the association of HSPC300 expression with clinical
Alberto Cascón et al.
Human mutation, 28(6), 613-621 (2007-02-22)
Clear cell renal cell carcinoma (ccRCC) is the most common malignant neoplasm of the kidney. The majority of hereditary and sporadic ccRCC cases are associated with germline and somatic mutations in the Von Hippel-Lindau gene (VHL), respectively. Gross deletions at
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.