추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
33 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ELOVL7(79993)
일반 설명
ELOVL7 (Elongation of very long chain fatty acids protein-7) is widely expressed, except for heart and skeletal muscle tissues. It belongs to ELOVL family of proteins.
면역원
Synthetic peptide directed towards the N terminal region of human ELOVL7
애플리케이션
Anti-ELOVL7 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
생화학적/생리학적 작용
Elongation of very long chain fatty acids protein-7 (ELOVL7) is a very long-chain fatty acid elongase with high activity towards acyl-CoA. It plays an important role in lipid metabolism of prostate cancer cells and might be the link between fat dietary intake and carcinogenesis.
서열
Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Yusuke Ohno et al.
Proceedings of the National Academy of Sciences of the United States of America, 107(43), 18439-18444 (2010-10-13)
Very long-chain fatty acids (VLCFAs) exert a variety of cellular functions and are associated with numerous diseases. However, the precise pathway behind their elongation has remained elusive. Moreover, few regulatory mechanisms for VLCFAs synthesis have been identified. Elongases catalyze the
Kenji Tamura et al.
Cancer research, 69(20), 8133-8140 (2009-10-15)
A number of epidemiologic studies have indicated a strong association between dietary fat intake and prostate cancer development, suggesting that lipid metabolism plays some important roles in prostate carcinogenesis and its progression. In this study, through our genome-wide gene expression
Tatsuro Naganuma et al.
FEBS letters, 585(20), 3337-3341 (2011-10-01)
Very long-chain fatty acids (VLCFAs) have a variety of physiological functions and are related to numerous disorders. The key step of VLCFA elongation is catalyzed by members of the elongase family, ELOVLs. Mammals have seven ELOVLs (ELOVL1-7), yet none of
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.