콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV48972

Sigma-Aldrich

Anti-C3ORF39 antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-AGO61, Anti-FLJ14566

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

66 kDa

종 반응성

human, dog, mouse, rat, horse, rabbit, guinea pig, bovine

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

유전자 정보

human ... C3orf39(84892)

면역원

Synthetic peptide directed towards the middle region of human C3orf39

애플리케이션

Anti-C3ORF39 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

생화학적/생리학적 작용

C3ORF39 also known as Protein O-linked mannose N-acetylglucosaminyltransferase 2 (POMGNT2; GTDC2) is a protein with glycosyltransferase activity. It is involved in the modification of O-mannosylated α-dystroglycan in the endoplasmic reticulum to generate N-acetyl glucosamine epitopes. Mutations in GTDC2 gene have been identified as the cause of Walker-Warburg syndrome.

서열

Synthetic peptide located within the following region: TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQYVAWRNMMPEN

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

M Chiara Manzini et al.
American journal of human genetics, 91(3), 541-547 (2012-09-11)
Whole-exome sequencing (WES), which analyzes the coding sequence of most annotated genes in the human genome, is an ideal approach to studying fully penetrant autosomal-recessive diseases, and it has been very powerful in identifying disease-causing mutations even when enrollment of
Mitsutaka Ogawa et al.
Biochemical and biophysical research communications, 440(1), 88-93 (2013-09-18)
Hypoglycosylation is a common characteristic of dystroglycanopathy, which is a group of congenital muscular dystrophies. More than ten genes have been implicated in α-dystroglycanopathies that are associated with the defect in the O-mannosylation pathway. One such gene is GTDC2, which
Reto Müller et al.
PloS one, 8(5), e62835-e62835 (2013-05-15)
The O-GlcNAc transferase Eogt modifies EGF repeats in proteins that transit the secretory pathway, including Dumpy and Notch. In this paper, we show that the Notch ligands Delta and Serrate are also substrates of Eogt, that mutation of a putative

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.