추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
38 kDa
종 반응성
rat, mouse, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... TOR1B(27348)
면역원
Synthetic peptide directed towards the C terminal region of human TOR1B
애플리케이션
Anti-TOR1B antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.
생화학적/생리학적 작용
TOR1B [Torsin family 1, member B (torsin B)] gene encodes a 336 amino acid containing protein, predominantly expressed in the developing human brain and belonging to ClpA/ClpB family and torsin subfamily. It plays a pivotal role in postnatal developmental events and is crucial for proper neurological development. TOR1B may also facilitate as a molecular chaperone assisting in the proper folding of secreted and membrane proteins. Mutation in TOR1B gene results in torsion dystonia, an autosomal dominant neurological disorder.
서열
Synthetic peptide located within the following region: VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
E Bahn et al.
Brain research, 1116(1), 112-119 (2006-08-30)
Familial, early onset, generalized torsion dystonia is the most common and severe primary dystonia. The majority of cases are caused by a 3-bp deletion (GAG) in the coding region of the DYT1 (TOR1A) gene. The cellular and regional distribution of
C Kamm et al.
Neurology, 67(10), 1857-1859 (2006-11-30)
Recently, association of a TOR1A(DYT1)/TOR1B risk haplotype with common forms of idiopathic dystonia has been reported in the Icelandic population. Here we report a strong association of two single nucleotide polymorphisms within or in close proximity to the TOR1A 3'UTR
Anju Vasudevan et al.
Brain research, 1073-1074, 139-145 (2006-02-07)
Early onset torsion dystonia is characterized by involuntary movements and distorted postures and is usually caused by a 3-bp (GAG) deletion in the DYT1 (TOR1A) gene. DYT1 codes for torsinA, a member of the AAA+ family of proteins, implicated in
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.