추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
72 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... KNG1(3827)
일반 설명
Kininogen 1 (KNG1) a precursor of the kinin has recently been identified as possible biomarkers for chronic hepatitis C and proliferative vitreoretinopathy (PVR).
특이성
Anti-KNG1 polyclonal antibody reacts with human and mouse kininogen 1 proteins.
면역원
Synthetic peptide directed towards the middle region of human KNG1
애플리케이션
Anti-KNG1 polyclonal antibody is used to tag kininogen 1 protein for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of kininogen 1 as a potential biomarker for chronic hepatitis C and proliferative vitreoretinopathy (PVR).
생화학적/생리학적 작용
Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
서열
Synthetic peptide located within the following region: YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Zhanna V Vysotskaya et al.
Respiratory physiology & neurobiology, 203, 35-44 (2014-09-07)
This study was carried out to investigate the expression of large-conductance Ca(2+)-activated potassium (BK) channels and to explore the possible modulation of BK channel activities by calcium-sensing receptors (CaSR) in rat bronchopulmonary sensory neurons. The expression of BK channels was
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.