콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

AV44142

Sigma-Aldrich

Anti-SLC39A5 (AB1) antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-LZT-Hs7, Anti-MGC34778, Anti-Solute carrier family 39 (metal ion transporter), member 5, Anti-ZIP5

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

56 kDa

종 반응성

mouse, human, rat, rabbit

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

면역원

Synthetic peptide directed towards the N terminal region of human SLC39A5

애플리케이션

Anti-SLC39A5 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.

생화학적/생리학적 작용

SLC39A5 (ZIP5) is a zinc uptake transporter that specifically transports Zn+2 ions. It is expressed in intestine, pancreas, liver and kidney. ZIP5 maintains zinc homeostasis and plays an important role in the uptake of dietary zinc across apical membrane of enterocytes in the intestine. Zinc transport by ZIP5 is important to protect the pancreatic acinar cells against zinc toxicity.

서열

Synthetic peptide located within the following region: MGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENG

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Jim Geiser et al.
PloS one, 8(11), e82149-e82149 (2013-12-05)
ZIP5 localizes to the baso-lateral membranes of intestinal enterocytes and pancreatic acinar cells and is internalized and degraded coordinately in these cell-types during periods of dietary zinc deficiency. These cell-types are thought to control zinc excretion from the body. The
Benjamin P Weaver et al.
Biometals : an international journal on the role of metal ions in biology, biochemistry, and medicine, 25(2), 319-335 (2011-11-25)
Translation of the basolateral zinc transporter ZIP5 is repressed during zinc deficiency but Zip5 mRNA remains associated with polysomes and can be rapidly translated when zinc is repleted. Herein, we examined the mechanisms regulating translation of Zip5. The 3'-untranslated region
Fudi Wang et al.
The Journal of biological chemistry, 279(49), 51433-51441 (2004-08-24)
The mouse and human Zip5 proteins are members of the ZIP family of metal ion transporters. In this study, we present evidence that mouse Zip5 is a zinc uptake transporter that is specific for Zn(II) over other potential metal ion

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.