콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

AV42487

Sigma-Aldrich

Anti-ASPN (AB3) antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Aporin, Anti-FLJ20129, Anti-PLAP1, Anti-SLRR1C

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

42 kDa

종 반응성

human, rat

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ASPN(54829)

일반 설명

Asporin, periodontal ligament-associated protein 1 (PLAP1), is a member of the family of small leucine-rich proteoglycan (SLRP) family. Asporin is present in the cartilage extracellular matrix (ECM) where it plays a role in collagen mineralization. Asporin is involved in the mineralizaion of human dental pulp stem cells and predentin to dentin. Asporin inhibits bone morphogenetic protein-2 (BMP-2)-induced cytodifferentiation of periodontal ligament (PDL) cells and has been implicated in osteoarthritis.

The previously assigned protein identifier Q5TBF3 has been merged into Q9BXN1. Full details can be found on the UniProt database.

특이성

Anti- PLAP1 (AB3) antibody reacts with canine, mouse, chicken, human, rat, and bovine Asporin (periodontal ligament-associated protein 1) proteins.

면역원

Synthetic peptide directed towards the middle region of human ASPN

애플리케이션

Anti- PLAP1 (AB3) antibody is used to tag asporin proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of asporin in cartilage mineralization and cytodifferentiation of cells such as periodontal ligament (PDL) cells.

생화학적/생리학적 작용

ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin.ASPN belongs to a family of leucine-rich repeat (LRR) proteins associated with the cartilage matrix. The name asporin reflects the unique aspartate-rich N terminus and the overall similarity to decorin (MIM 125255) (Lorenzo et al., 2001).[supplied by OMIM].

서열

Synthetic peptide located within the following region: NKISTVELEDFKRYKELQRLGLGNNKITDIENGSLANIPRVREIHLENNK

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Shengjie Wang et al.
Scientific reports, 7(1), 4112-4112 (2017-06-25)
Disc degeneration (DD) is a multifaceted chronic process that alters the structure and function of intervertebral discs. The pathophysiology of degeneration is not completely understood, but the consensus is that changes in genes encoding extracellular matrix (ECM) proteins in the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.