AV40417
Anti-PSMA1 antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-HC2, Anti-MGC14542, Anti-MGC14575, Anti-MGC14751, Anti-MGC1667, Anti-MGC21459, Anti-MGC22853, Anti-Proteasome (prosome, macropain) subunit, α type, 1
로그인조직 및 계약 가격 보기
모든 사진(3)
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
29 kDa
종 반응성
mouse, human, dog, rabbit, rat, horse, bovine, guinea pig
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... PSMA1(5682)
일반 설명
Proteasome (prosome, macropain) subunit, α type, 1 (PSMA1), a T1A family peptidase, is an α subunit of the complex 20S core structure of the proteosome, a multicatalytic proteinase complex.
특이성
Anti-PSMA1 polyclonal antibody reacts with bovine, human, mouse, rat, chicken, zebrafish, and canine proteasome (prosome, macropain) subunit, α type, 1 proteins.
면역원
Synthetic peptide directed towards the C terminal region of human PSMA1
애플리케이션
Anti-PSMA1 polyclonal antibody is used to tag pregnancy specific proteasome (prosome, macropain) subunit, α type, 1 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles proteasome (prosome, macropain) subunit, α type, 1 in proteasome structure and function.
생화학적/생리학적 작용
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA1 is a member of the peptidase T1A family which is a 20S core alpha subunit.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Two alternative transcripts encoding different isoforms have been identified.
서열
Synthetic peptide located within the following region: TYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Yu-Jun He et al.
World journal of gastroenterology, 20(33), 11840-11849 (2014-09-11)
To investigate the molecular mechanisms of the anti-cancer activity of caffeic acid phenethyl ester (CAPE). Protein profiles of human colorectal cancer SW480 cells treated with or without CAPE were analysed using a two-dimensional (2D) electrophoresis gel-based proteomics approach. After electrophoresis
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.