추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
76 kDa
종 반응성
human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CTCFL(140690)
일반 설명
CTFL also known as BORIS is a repressor of the transcription factor CTCF. It appears to be expressed primarily in the cytoplasm of spermatocytes.
면역원
Synthetic peptide directed towards the N terminal region of human CTCFL
생화학적/생리학적 작용
CTCFL is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes. CTCFL is normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation.
서열
Synthetic peptide located within the following region: RSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCD
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 2
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Dmitri I Loukinov et al.
Proceedings of the National Academy of Sciences of the United States of America, 99(10), 6806-6811 (2002-05-16)
CTCF, a conserved, ubiquitous, and highly versatile 11-zinc-finger factor involved in various aspects of gene regulation, forms methylation-sensitive insulators that regulate X chromosome inactivation and expression of imprinted genes. We document here the existence of a paralogous gene with the
Renata Novak Kujundžić et al.
Pathology oncology research : POR, 20(3), 687-695 (2014-02-25)
BORIS is a paralog of a highly conserved, multi-functional chromatin factor CTCF. Unlike CTCF, which has been shown to possess tumor-suppressive properties, BORIS belongs to the "cancer/testis antigen" family normally expressed only in germ cells and aberrantly activated in a
Michele Zampieri et al.
Biochimica et biophysica acta, 1839(9), 813-825 (2014-07-02)
Aberrant upregulation of NOTCH3 gene plays a critical role in cancer pathogenesis. However, the underlying mechanisms are still unknown. We tested here the hypothesis that aberrant epigenetic modifications in the NOTCH3 promoter region might account for its upregulation in cancer
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.