추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
64 kDa
종 반응성
pig, rabbit, dog, human
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... MCOLN1(57192)
일반 설명
MCOLN1 codes for a transmembrane protein that is found in vesicles. It is involved in endocytosis and lysosomal exocytosis. MCOLN1 mutations have been associated with the neurodegenerative lysosomal storage disorder, mucolipidosis type IV (MLIV).
Rabbit Anti-MCOLN1 antibody recognizes bovine, canine, human, rat, and mouse MCOLN1.
Rabbit Anti-MCOLN1 antibody recognizes bovine, canine, human, rat, and mouse MCOLN1.
면역원
Synthetic peptide directed towards the N terminal region of human MCOLN1
애플리케이션
Rabbit Anti-MCOLN1 antibody is suitable for western blot applications at a concentration of 0.5 μg/ml.
생화학적/생리학적 작용
MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.
서열
Synthetic peptide located within the following region: FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Gideon Bach et al.
Human mutation, 26(6), 591-591 (2005-11-16)
Mucolipidosis type IV (MLIV) is a neurodegenerative lysosomal storage disorder that occurs in an increased frequency in the Ashkenazi Jewish (AJ) population. The frequency of the disease in this population has been established by the testing of 66,749 AJ subjects
Math P Cuajungco et al.
Traffic (Copenhagen, Denmark), 15(11), 1247-1265 (2014-08-19)
Mucolipidosis type IV (MLIV) is caused by loss of function mutations in the TRPML1 ion channel. We previously reported that tissue zinc levels in MLIV were abnormally elevated; however, the mechanism behind this pathologic accumulation remains unknown. Here, we identify
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.