콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV33623

Sigma-Aldrich

Anti-CLDN1 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-Claudin 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

23 kDa

종 반응성

human, dog, sheep, horse, bovine, guinea pig

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... CLDN1(9076)

일반 설명

Claudin-1 (CLDN1) membrane protein belongs to the claudin family. It comprises four membrane-spanning regions, N- and C-terminal cytoplasmic domains, and two extracellular loops. The CLDN1 gene is mapped to human chromosome 3q28. It is expressed in the kidney, testis, intestine, brain, and liver.

면역원

Synthetic peptide directed towards the C terminal region of human CLDN1

생화학적/생리학적 작용

Claudin-1 (CLDN1) is a key component of the tight junctions that mediate epithelial barrier functions. CLDN1 is dichotomous as it is downregulated in breast, esophageal and prostate cancer. The gene is overexpressed in oral squamous cell cancer, colon, nasopharyngeal and ovarian tumors. It is implicated in neonatal sclerosing cholangitis (NISCH) syndrome. CLDN1 is involved in dengue (DENV) entry and acts as a co-receptor for hepatitis C virus (HCV) entry.

서열

Synthetic peptide located within the following region: GQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDYV

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Ajaz A Bhat et al.
International journal of molecular sciences, 21(2) (2020-01-19)
Claudins, a group of membrane proteins involved in the formation of tight junctions, are mainly found in endothelial or epithelial cells. These proteins have attracted much attention in recent years and have been implicated and studied in a multitude of
Pulin Che et al.
Virology, 446(1-2), 303-313 (2013-10-01)
Dengue disease is becoming a huge public health concern around the world as more than one-third of the world's population living in areas at risk of infection. In an effort to assess host factors interacting with dengue virus, we identified
Anne A Blanchard et al.
PloS one, 11(9), e0163387-e0163387 (2016-09-21)
The claudin 1 tight junction protein, solely responsible for the barrier function of epithelial cells, is frequently down regulated in invasive human breast cancer. The underlying mechanism is largely unknown, and no obvious mutations in the claudin 1 gene (CLDN1)
Smail Hadj-Rabia et al.
Gastroenterology, 127(5), 1386-1390 (2004-11-03)
Most human and animal cholestatic disorders are associated with changes in hepatocyte cytoskeleton and tight junctions (TJs). These changes are usually secondary and nonspecific phenomena, both in intra- and extrahepatic cholestasis. Recently, missense mutations in TJ protein 2 (ZO-2) have
Juha Virman et al.
Anticancer research, 34(8), 4181-4187 (2014-07-31)
Claudins are tight junction proteins and their expression is often different in normal and corresponding tumor cells. In the present study, we determined how the expression of claudins 1-5 and 7 correlated to survival, grade and stage of patients with

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.