추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
27 kDa
종 반응성
mouse, guinea pig, sheep, rabbit, horse, rat, goat, bovine, dog, human
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... MYF6(4618)
일반 설명
MyF6 is a possible helix-loop-helix protein that may be involved in muscle differentiation. It is known to have conserved DNA binding and dimerization domains.
Rabbit Anti-MyF6 antibody recognizes canine, human, mouse, rat, bovine, zebrafish, pig, and chicken MyF6.
Rabbit Anti-MyF6 antibody recognizes canine, human, mouse, rat, bovine, zebrafish, pig, and chicken MyF6.
면역원
Synthetic peptide directed towards the N terminal region of human MYF6
애플리케이션
Rabbit Anti-MyF6 antibody can be used for western blot applications at a concentration of 1μg/ml.
생화학적/생리학적 작용
MYF6 is a part of the myogenic basic helix-loop-helix family of transcription factors, and can activate the muscle differentiation program.
서열
Synthetic peptide located within the following region: PGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEA
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
T Braun et al.
Nucleic acids research, 19(20), 5645-5651 (1991-10-25)
The muscle regulatory proteins Myf3, Myf4, Myf5, and Myf6 share a highly conserved DNA binding and dimerization domain consisting of a cluster of basic amino acids and a potential helix-loop-helix structure. Here we demonstrate that the four human muscle-specific HLH
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.