추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
51 kDa
종 반응성
bovine, mouse, rabbit, horse, human, rat, guinea pig, dog
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SMAD5(4090)
유사한 제품을 찾으십니까? 방문 제품 비교 안내
일반 설명
SMAD5 is known to mediate TGFβ signaling. Studies in mice have shown that Smad5 mutations can be linked to angiogenic defects, mesenchymal apoptosis and embryonic death.
Rabbit Anti-SMAD5 antibody recognizes bovine, chicken, human, mouse, rat, zebrafish, and canine SMAD5.
Rabbit Anti-SMAD5 antibody recognizes bovine, chicken, human, mouse, rat, zebrafish, and canine SMAD5.
면역원
Synthetic peptide directed towards the middle region of human SMAD5
애플리케이션
Rabbit Anti-SMAD5 antibody can be used for western blot applications at a concentration of 1.0μg/ml.
생화학적/생리학적 작용
SMAD5 undergoes copy number gain and increased expression, rather than loss of expression, and therefore does not act as a tumor-suppressor gene in hepatocellular carcinoma. Up-regulated Smad5 mediates apoptosis of gastric epithelial cells induced by Helicobacter pylori infection.
서열
Synthetic peptide located within the following region: YPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMD
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
H Chang et al.
Development (Cambridge, England), 126(8), 1631-1642 (1999-03-18)
Smad5 has been implicated as a downstream signal mediator for several bone morphogenetic proteins (BMPs). To understand the in vivo function of Smad5, we generated mice deficient in Smad5 using embryonic stem (ES) cell technology. Homozygous mutant embryos die between
X Yang et al.
Development (Cambridge, England), 126(8), 1571-1580 (1999-03-18)
The transforming growth factor-beta (TGF-beta) signals are mediated by a family of at least nine SMAD proteins, of which SMAD5 is thought to relay signals of the bone morphogenetic protein (BMP) pathway. To investigate the role of SMAD5 during vertebrate
Jonathan R Peterson et al.
Science translational medicine, 6(255), 255ra132-255ra132 (2014-09-26)
Heterotopic ossification (HO) is the pathologic development of ectopic bone in soft tissues because of a local or systemic inflammatory insult, such as burn injury or trauma. In HO, mesenchymal stem cells (MSCs) are inappropriately activated to undergo osteogenic differentiation.
Ludovic Peyre et al.
Toxicology in vitro : an international journal published in association with BIBRA, 28(8), 1507-1520 (2014-07-06)
Pesticides as well as many other environmental pollutants are considered as risk factors for the initiation and the progression of cancer. In order to evaluate the in vitro effects of chemicals present in the diet, we began by combining viability
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.