추천 제품
일반 설명
Rabbit polyclonal anti-TRH antibody reacts with zebrafish, human, canine, chicken, and bovine thyrotrophin-releasing hormones.
Thyrotropin-releasing hormone/thyrotropin-releasing factor (TRH, TRF) is a tripeptidal hormone that stimulates the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. TRH is a highly specific regulator of the thyrotropin-stimulating hormone (TSHβ) gene expression in the pituitary via a nerve growth factor IB (NGFIB, NR4A1, Nur77)/PKC/ERK1/2 pathway.
면역원
Synthetic peptide directed towards the C terminal region of human TRH
애플리케이션
Rabbit polyclonal anti-TRH antibody is used to tag thyrotrophin-releasing hormone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of thyrotrophin-releasing hormone in the regulation of the synthesis and release of TSH (thyroid-stimulating hormone) and prolactin from the anterior pituitary. Anti-TRH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
서열
Synthetic peptide located within the following region: RALGGPCGPQGAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
12 - Non Combustible Liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.