콘텐츠로 건너뛰기
Merck
모든 사진(3)

주요 문서

AV100880

Sigma-Aldrich

Anti-EGR2 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-CMT1D, Anti-CMT4E, Anti-DKFZp686J1957, Anti-Early growth response 2 (Krox-20 homolog, Drosophila), Anti-FLJ14547, Anti-KROX20

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

50 kDa

종 반응성

mouse, bovine, human

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... EGR2(1959)

일반 설명

Early growth response (EGR) proteins are transcriptional regulators (EGR1-4) of gene expression involved in the growth and differentiation of many cells. Early growth response 2 (EGR2, Krox20, CMT1D, CMT4E), a C2H2-type zinc-finger protein, regulates a wide spectrum of cellular responses including differentiation (osteoclast), tissue (brain) patterning, and apoptosis.

특이성

Rabbit polyclonal anti-EGR2 antibody reacts with zebrafish, canine, human, mouse, rat, and pig early growth response 2 factors.

면역원

Synthetic peptide directed towards the C terminal region of human EGR2

애플리케이션

Rabbit polyclonal anti-EGR2 antibody is used to tag early growth response 2 factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of early growth response 2 factor in cell processes such as differentiation (osteoclast), tissue (brain) patterning, and apoptosis. Anti-EGR2 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

서열

Synthetic peptide located within the following region: PFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSASVPAPSTASCSGG

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Yankel Gabet et al.
Blood, 116(19), 3964-3971 (2010-08-19)
Krox20/EGR2, one of the 4 early growth response genes, is a highly conserved transcription factor implicated in hindbrain development, peripheral nerve myelination, tumor suppression, and monocyte/macrophage cell fate determination. Here, we established a novel role for Krox20 in postnatal skeletal
Charlotte Labalette et al.
Development (Cambridge, England), 138(2), 317-326 (2010-12-24)
Vertebrate hindbrain segmentation is an evolutionarily conserved process that involves a complex interplay of transcription factors and signalling pathways. Fibroblast growth factor (FGF) signalling plays a major role, notably by controlling the expression of the transcription factor Krox20 (Egr2), which
V P Sukhatme
Journal of the American Society of Nephrology : JASN, 1(6), 859-866 (1990-12-01)
How eucaryotic cells respond to growth signals is a topic of considerable interest. Though much attention has focused on second messenger pathways, in recent years, progress has been made on elucidating the transcriptional events that lie more distally in the
Hozo Matsuoka et al.
International journal of molecular sciences, 19(2) (2018-02-09)
Neurotropin® (NTP), a non-protein extract of inflamed rabbit skin inoculated with vaccinia virus, is clinically used for the treatment of neuropathic pain in Japan and China, although its effect on peripheral nerve regeneration remains to be elucidated. The purpose of

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.