생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
73 kDa
종 반응성
pig, bovine, human, mouse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... TCF12(6938)
일반 설명
TCF12 belongs to the Tcf family of transcription factors that activate genes induced by the Wnt pathway.
면역원
Synthetic peptide directed towards the N terminal region of human TCF12
애플리케이션
Anti-TCF12 (AB2) antibody produced in rabbit rabbit is suitable for western blotting at a concentration of 1 μg/ml.
생화학적/생리학적 작용
TCF12 suppresses the expression of E-cadherin mRNA in metastatic colorectal cancer cells. The overexpression of TCF12 facilitates cell migration and invasion of these cells. TCF12 has a possible role in maintaining neural stem cells and progenitor cells in undifferentiated state during neurogenesis.
서열
Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
M Uittenbogaard et al.
Brain research. Gene expression patterns, 1(2), 115-121 (2004-03-17)
In this study, we focused on the potential function of the murine gene Tcf12 (also known as ME1 or HEB) encoding the bHLH E-protein ME1 during brain development. An exencephaly phenotype of low penetrance has consistently been observed in both
Chun-Chung Lee et al.
The Journal of biological chemistry, 287(4), 2798-2809 (2011-12-02)
A correlation of TCF12 mRNA overexpression with colorectal cancer (CRC) metastasis was suggested by microarray data and validated by the survey of 120 patients. Thirty-three (27.5%) of the 120 patients showed tumor TCF12 mRNA overexpression and had a higher rate
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.