추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
CL1095, monoclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry: 1:200- 1:500
동형
IgG1
Ensembl | 인체 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... RHOT1(55288)
일반 설명
Miro1/RHOT1 (ras homolog family member T1) is an outer mitochondrial membrane (OMM) protein. It has a transmembrane domain, two GTPase domains and two Ca2+-sensing EF-hand domains. RHOT1 is located on human chromosome 17q11.
면역원
ras homolog family member T1, recombinant protein epitope signature tag (PrEST)
Sequence
THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
Epitope
Binds to an epitope located within the peptide sequence ERTDKDSRLP as determined by overlapping synthetic peptides.
Sequence
THIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIE
Epitope
Binds to an epitope located within the peptide sequence ERTDKDSRLP as determined by overlapping synthetic peptides.
애플리케이션
Monoclonal Anti-RHOT1 antibody has been used in Immunoprecipitation.
생화학적/생리학적 작용
Miro1/RHOT1 (ras homolog family member T1) regulates mitochondrial trafficking and distribution. The Rho GTPase Miro-1 plays a crucial role in the modulation of mitochondrial morphogenesis and acts as a calcium-dependent sensor for the control of mitochondrial motility.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST71907
물리적 형태
Phospate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
K27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase.
Birsa N, et al.
The Journal of Biological Chemistry, jbc-M114 (2014)
K27 ubiquitination of the mitochondrial transport protein Miro is dependent on serine 65 of the Parkin ubiquitin ligase.
Birsa N, et al.
Test, jbc-M114 (2014)
Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity
Morlino G, et al.
Molecular and Cellular Biology, MCB-01177 (2014)
Evidence-based genomic diagnosis characterized chromosomal and cryptic imbalances in 30 elderly patients with myelodysplastic syndrome and acute myeloid leukemia
Bajaj R, et al.
Molecular Cytogenetics, 4(1), 3-3 (2011)
Miro-1 links mitochondria and microtubule Dynein motors to control lymphocyte migration and polarity
Morlino G, et al.
Molecular and cellular biology, MCB-01177 (2014)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.