Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

SAB2102600

Sigma-Aldrich

Anti-TTYH1 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Tweety homolog 1 (Drosophila)

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

49 kDa

species reactivity

human, rabbit, guinea pig, mouse, bovine, rat, dog

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TTYH1(57348)

Immunogen

Synthetic peptide directed towards the N terminal region of human TTYH1

Application

Anti-TTYH1 antibody produced in rabbit has been used in western blotting.

Biochem/physiol Actions

TTYH1 is a member of the tweety family of proteins. Members of this family function as chloride anion channels. TTYH1 functions as a calcium (2+)-independent, volume-sensitive large conductance chloride (-) channel. This gene encodes a member of the tweety family of proteins. Members of this family function as chloride anion channels. The encoded protein functions as a calcium(2+)-independent, volume-sensitive large conductance chloride(-) channel. Two transcript variants encoding distinct isoforms have been identified for this gene.

Sequence

Synthetic peptide located within the following region: GAPPGYRPSAWVHLLHQLPRADFQLRPVPSVFAPQEQEYQQALLLVAALA

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Jenna M Carter et al.
Alcoholism, clinical and experimental research, 40(2), 301-308 (2016-02-05)
Ethanol is widely known for its depressant effects; however, the underlying neurobiological mechanisms are not clear. Calcium-activated anion channels (CAACs) contribute to extracellular chloride levels and thus may be involved in regulating inhibitory mechanisms within the central nervous system. Therefore
Expression of Ttyh1, a member of the Tweety family in neurons in vitro and in vivo and its potential role in brain pathology.
Stefaniuk M
Journal of Neurochemistry, 115, 1183-1194 (2010)
Long-term survival in a case of ETANTR with histological features of neuronal maturation after therapy.
Antonelli M
Virchows Archiv, 466, 603-607 (2015)

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service