Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

SAB1405525

Sigma-Aldrich

Anti-TSPO antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonym(s):

BZRP, DBI, IBP, MBR, PBR, PKBS, PTBR, TSPO Antibody - Anti-TSPO antibody produced in mouse, Tspo Antibody, mDRC, pk18

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

Quality Level

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen ~18.8 kDa

species reactivity

human

technique(s)

western blot: 1 μg/mL

NCBI accession no.

UniProt accession no.

shipped in

dry ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... TSPO(706)

General description

Translocator protein (TSPO) contains five α helices. The TSPO gene is mapped to human chromosome 22q13.2. It is expressed in activated microglia.

Immunogen

TSPO (AAH01110.1, 1 a.a. ~ 169 a.a) full-length human protein.

Sequence
MAPPWVPAMGFTLAPSLGCFVGSRFVHGEGLRWYAGLQKPSWHPPHWVLGPVWGTLYSAMGYGSYLVWKELGGFTEKAVVPLGLYTGQLALNWAWPPIFFGARQMGWALVDLLLVSGAAAATTVAWYQVSPLAARLLYPYLAWLAFATTLNYCVWRDNHGWHGGRRLPE

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Flow cytometry/Cell sorting (1 paper)

Biochem/physiol Actions

Translocator protein (TSPO) serves as a marker for microglial activation. The levels of TSPO are elevated in multiple sclerosis, Huntington′s disease (HD), and brain ischemia as well as in gliomas. TSPO functions as a key target for understanding neuroinflammation and has applications in positron emission tomography (PET) imaging. It also binds to cholesterol. The TSPO gene polymorphism may be associated with the pathophysiology of panic attacks, bipolar disorder, and anxiety. Together with voltage-dependent anion channel (VDAC), TSPO regulates terminal erythropoiesis as well as autophagy in mitochondria.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Aniello DE Rosa et al.
Oncology letters, 9(3), 1327-1332 (2015-02-11)
Principally located in the outer mitochondrial membrane, the translocator protein (TSPO) is an 18-kDa transmembrane protein that is a key component of the mitochondrial permeability transition pore. TSPO is associated with a number of biological processes, including apoptosis, the regulation
Laura Airas et al.
Clinical and translational imaging, 3, 461-473 (2015-01-01)
Conventional MR imaging (MRI) techniques form the cornerstone of multiple sclerosis (MS) diagnostics and clinical follow-up today. MRI is sensitive in demonstrating focal inflammatory lesions and diffuse atrophy. However, especially in progressive MS, there is increasingly widespread diffuse pathology also
Biljana Musicki et al.
Journal of cellular physiology, 236(4), 3073-3082 (2020-09-26)
Priapism, a prolonged penile erection in the absence of sexual arousal, is common among patients with sickle cell disease (SCD). Hypogonadism is also common in patients with SCD. While the administration of exogenous testosterone reverses hypogonadism, it is contraceptive. We
Xiaoming Liu et al.
The Journal of steroid biochemistry and molecular biology, 143, 130-140 (2014-03-13)
Although progesterone was reported to be a neuroprotective agent against injuries to the nervous system, including the peripheral neuropathy, the mechanisms of its dose or timing-related effects remain unclear. Translocator protein (TSPO) is predominantly located in the mitochondrial outer membrane

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service