Skip to Content
MilliporeSigma
All Photos(6)

Key Documents

HPA017432

Sigma-Aldrich

Anti-MGAT1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase, Anti-GNT-I, Anti-GlcNAc-T I, Anti-N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase I

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

AVIPILVIACDRSTVRRCLDKLLHYRPSAELFPIIVSQDCGHEETAQAIASYGSAVTHIRQPDLSSIAVPPDHRKFQGYYKIARHYRWALGQVFRQFRFPAAVVVEDDLEVAPDFFEYFRATYPLLKADPSLWCVSAWNDNGKEQMVD

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

glycosylation

Gene Information

human ... MGAT1(4245)

General description

Mannosyl-(α-1, 3)-glycoprotein-β-1, 2-N-acetylglucosaminyltransferase (MGAT1) gene is mapped to human chromosome 5q35. It codes for a 445 amino acid transmembrane protein with a luminal catalytic domain, localized to the medial compartment of the Golgi apparatus.
MGAT1 gene is a housekeeping gene. It is expressed as two RNA transcripts, smaller one of 2.7-3.0kb and larger of 3.1kb. Both are expressed in heart, lung, skeletal muscle and pancreas. However, only larger transcript is present in the brain.

Immunogen

Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

MGAT1 (mannosyl-(α-1, 3)-glycoprotein-β-1, 2-N-acetylglucosaminyltransferase 1) catalyzes the first step in the conversion of oligomannose to N-glycans. Members of MGAT enzyme family play a vital role in dietary fat absorption. Cell surface proteins, N-glycosylated by MGAT1, assist in cell–cell interactions and binding of cytokines and various other factors to the outer plasma membrane. MGAT1 gene is found to be significantly associated with body weight among women .

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST71926

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

R Kumar et al.
Proceedings of the National Academy of Sciences of the United States of America, 87(24), 9948-9952 (1990-12-01)
This laboratory has previously identified a human gene encoding N-acetylglucosaminyltransferase I (GlcNAc-TI; EC 2.4.1.101) by complementation of the glycosylation defect in the Lec1 Chinese hamster ovary (CHO) cell mutant. A phage lambda library prepared from genomic DNA of a tertiary
B Yip et al.
The Biochemical journal, 321 ( Pt 2), 465-474 (1997-01-15)
UDP-GlcNAc: alpha-3-D-mannoside beta-1,2-N-acetylglucosaminyltransferase I (EC 2.4.1.101; GlcNAc-T I) is a medial-Golgi enzyme which catalyses the first step in the conversion of oligomannose-type to N-acetyl-lactosamine- and hybrid-type N-glycans and is essential for normal embryogenesis in the mouse. Previous work indicated the
Asa Johansson et al.
Obesity (Silver Spring, Md.), 18(4), 803-808 (2009-10-24)
As major risk-factors for diabetes and cardiovascular diseases, the genetic contribution to obesity-related traits has been of interest for decades. Recently, a limited number of common genetic variants, which have replicated in different populations, have been identified. One approach to
J A Jacobsson et al.
International journal of obesity (2005), 36(1), 119-129 (2011-02-10)
Recently a genome-wide association analysis from five European populations identified a polymorphism located downstream of the mannosyl-(α-1,3)-glycoprotein-β-1,2-N-acetylglucosaminyltransferase (MGAT1) gene that was associated with body-weight. In the present study, associations between MGAT1 variants combined with obesity and insulin measurements were investigated
K Ohtani et al.
The Journal of biological chemistry, 274(19), 13681-13689 (1999-05-01)
Collectins are a C-lectin family with collagen-like sequences and carbohydrate recognition domains. These proteins can bind to carbohydrate antigens of microorganisms and inhibit their infection by direct neutralization and agglutination, the activation of complement through the lectin pathway, and opsonization

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service