Skip to Content
MilliporeSigma
All Photos(4)

Key Documents

HPA010844

Sigma-Aldrich

Anti-DHRS3 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-DD831, Anti-Retinal short-chain dehydrogenase/reductase 1, Anti-Short-chain dehydrogenase/reductase 3, Anti-retSDR1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

mouse, human, rat

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:20-1:50

immunogen sequence

TEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPG

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... DHRS3(9249)

General description

DHRS3 (dehydrogenase/reductase member 3) is an all-trans-retinol dehydrogenase, which belongs to short-chain dehydrogenase/reductase (SDR) family. This gene is localized to human chromosome 1p35.1.7 and is widely expressed in multiple adult and fetal tissues. However, it is predominantly expressed in cone photoreceptors. The mRNA for DHRS3 is absent in brain. DHRS3 contains the motifs characteristic of SDR family such as, YXXXK motif, the catalytic Ser-175 residue, the serine residue before Ly-192 which is highly conserved, TGXXXGXG motif which is a nucleotide binding motif and is highly conserved.

Immunogen

Short-chain dehydrogenase/reductase 3 recombinant protein epitope signature tag (PrEST)

Application

Anti-DHRS3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem/physiol Actions

DHRS3 (dehydrogenase/reductase member 3) has a supposed role in the metabolism of retinoid and lipid. In cone photoreceptors, it regulates the conversion of retinal to retinol in the visual cycle. However, its wide expression in multiple human tissues, suggest that DHRS3 might play a general part in the metabolism of retinol. It acts as an all-trans-retinaldehyde-specific reductase, and becomes completely active only after activation by retinol dehydrogenase 10 (RDH10). It thus, reduces the rate of retinoic acid synthesis, by converting retinal back to retinol. In neuroblastoma (NB) cells which show overexpression of MYCN (v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog), DHRS3 is usually deleted, which leads to compromised sensitivity of NB cells to retinol. Thus, DHRS3 might be responsible for tumorigenesis of NB and its progression. It is suggested that DHRS3 also plays a role in developmental processes and tumor suppression via p53 and p63 pathway.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72127

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Mark K Adams et al.
The Journal of biological chemistry, 289(21), 14868-14880 (2014-04-16)
The retinoic acid-inducible dehydrogenase reductase 3 (DHRS3) is thought to function as a retinaldehyde reductase that controls the levels of all-trans-retinaldehyde, the immediate precursor for bioactive all-trans-retinoic acid. However, the weak catalytic activity of DHRS3 and the lack of changes
F Haeseleer et al.
The Journal of biological chemistry, 273(34), 21790-21799 (1998-08-15)
The reduction of all-trans-retinal in photoreceptor outer segments is the first step in the regeneration of bleached visual pigments. We report here the cloning of a dehydrogenase, retSDR1, that belongs to the short-chain dehydrogenase/reductase superfamily and localizes predominantly in cone
Ralf D Kirschner et al.
Cell cycle (Georgetown, Tex.), 9(11), 2177-2188 (2010-06-15)
Retinol and its metabolites have important roles in many processes including embryonic development, cellular differentiation, apoptosis and maintenance of epithelia. Retinal short-chain dehydrogenase/reductase retSDR1, also known as dehydrogenase/reductase member 3 (DHRS3), is involved in maintaining the cellular supply of retinol
Chad Deisenroth et al.
The Journal of biological chemistry, 286(32), 28343-28356 (2011-06-11)
The transcription factor p53 plays a critical role in maintaining homeostasis as it relates to cellular growth, proliferation, and metabolism. In an effort to identify novel p53 target genes, a microarray approach was utilized to identify DHRS3 (also known as
Fabio Cerignoli et al.
Cancer research, 62(4), 1196-1204 (2002-02-28)
Vitamin A is required for a number of developmental processes and for the homeostatic maintenance of several adult differentiated tissues and organs. In human neuroblastoma (NB) cells as well as some other tumor types, pharmacological doses of retinoids are able

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service