Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV38756

Sigma-Aldrich

Anti-PEG3 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-Paternally expressed 3

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

mol wt

181 kDa

species reactivity

dog, bovine, rabbit, human, horse, pig

packaging

pkg of 100 μL buffered aqueous solution
pkg of 50 μg lyophilized powder

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

storage temp.

−20°C

target post-translational modification

unmodified

Gene Information

human ... PEG3(5178)

General description

Paternally expressed 3 (PEG3, PW1) is involved in maternal genomic imprinting that is paternally expressed. Paternal expression of PEG3 regulates sexually experience effects on male behavior in mammals involving display of sexual behavior, aggression, and olfaction. PEGS reglulates sexual experience dependent preferences for estrous odors. PW1 identifies multiple adult stem and progenitor cell populations and serves as a marker for competent self-renewing stem cells in a wide array of adult tissues. Peg3/Pw1 is involved in the p53-mediated cell death pathway as a downstream effector of p53 in brain ischemia/hypoxia.

Specificity

Anti-PEG3 polyclonal antibody reacts with bovine, canine, pig, human, mouse, rat paternally expressed 3 proteins.

Immunogen

Synthetic peptide directed towards the C terminal region of human PEG3

Application

Anti-PEG3 polyclonal antibody is used to tag paternally expressed 3 for detection and quantitation by Western blotting and in plasma by immunohistochemical (IHC) techniques. It is used as a probe to determine the roles of paternally expressed 3 in genomic imprinting of male sexual behaviour, as a marker for competent self-renewing stem cells and in p53-mediated cell death.

Biochem/physiol Actions

PEG3 induces apoptosis in cooperation with SIAH1A and acts as a mediator between TP53/p53 and BAX in a neuronal death pathway that is activated by DNA damage. PEG3 acts synergistically with TRAF2 and inhibits TNF induced apoptosis through activation of NF-kappa-B. PEG3 also possesses a tumor suppressing activity in glioma cells.

Sequence

Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Ovijit Chaudhuri et al.
Nature communications, 6, 6364-6364 (2015-02-20)
Studies of cellular mechanotransduction have converged upon the idea that cells sense extracellular matrix (ECM) elasticity by gauging resistance to the traction forces they exert on the ECM. However, these studies typically utilize purely elastic materials as substrates, whereas physiological

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service