Skip to Content
MilliporeSigma
All Photos(1)

Key Documents

AV07030

Sigma-Aldrich

Anti-CXCR6 antibody produced in rabbit

affinity isolated antibody

Synonym(s):

Anti-BONZO, Anti-CD186, Anti-Chemokine (C-X-C motif) receptor 6, Anti-STRL33, Anti-TYMSTR

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
NACRES:
NA.43

biological source

rabbit

Quality Level

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

39 kDa

species reactivity

human

concentration

0.5 mg - 1 mg/mL

technique(s)

western blot: suitable

NCBI accession no.

UniProt accession no.

shipped in

wet ice

storage temp.

−20°C

Gene Information

human ... CXCR6(10663)

Immunogen

Synthetic peptide directed towards the N terminal region of human CXCR6

Application

Anti- CXCR6 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.

Biochem/physiol Actions

CXCR6, a chemokine receptor binds CXCL16 and promotes invasion and tumor growth. It is expressed by activated T cells in inflammatory diseases such as Crohn′s disease and is associated with poor prognosis of hepatocellular carcinoma and bladder cancer.

Sequence

Synthetic peptide located within the following region: AEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSL

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Qiang Gao et al.
Cancer research, 72(14), 3546-3556 (2012-06-20)
CXC chemokines and their cognate receptors have been implicated widely in cancer pathogenesis. In this study, we report a critical causal relationship between CXCR6 expression and tumorigenesis in the setting of human hepatocellular carcinoma (HCC). Among the CXC chemokine receptors
Yasushi Mandai et al.
PloS one, 8(6), e65488-e65488 (2013-07-11)
CD4(+) T cells play a central role in the development of inflammatory bowel disease (IBD) via high-level production of effector cytokines such as IFN-γ and TNF-α. To better characterize the colitogenic CD4(+) T cells, we examined their expression of CXCR6
Jun Taik Lee et al.
Oncology letters, 5(1), 229-235 (2012-12-21)
The interactions between chemokines and their receptors are closely involved in the progression and metastasis of cancer. We hypothesized that the CXCL16-CXCR6 ligand-receptor system plays an important role in bladder cancer progression. To evaluate this hypothesis, the expression levels of

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service