SAB6100012

Anti-AA2AR / Adenosine A2aR Reference Antibody

• Synonym(s): A2aR

Properties

• recombinant: expressed in CHO cells
• Quality Level: 100
• conjugate: unconjugated
• antibody product type: primary antibodies
• clone: recombinant monoclonal
• form: lyophilized
• species reactivity: human
• concentration: 1 mg/mL
• optimum pH: 6.2
• pH range: 5.5-6.16
• immunogen sequence: MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYFNFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVGLFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFRKIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNGYALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
• Protein ID accession no.: NP_000666
• UniProt accession no.: P29274
• storage temp.: -65 to -96°C
• target post-translational modification: unmodified
• Gene Information: human ... ADORA2A(135)

Description

General description

Anti-AA2AR / Adenosine A2aR Reference Antibody, expressed from CHO cells, with a heavy chain type of IgG1 and a light chain type of hukappa, has a predicted MW of 146.66 kDa. This antibody is instrumental across various research applications. It facilitates ELISA assays for quantifying Adenosine A2aR expression levels, FACS for precise cell sorting, kinetic studies to analyze its binding properties, functional assays to assess its biological activity, and utilization in animal models to evaluate its efficacy and safety profiles in vivo. These applications provide comprehensive insights into its potential therapeutic applications, particularly in the fields of immunology and neuroscience.

Immunogen

ADORA2A

Packaging

100ug/vial; 1mg/vial

Reconstitution

For reconstitution, we recommend adding sterile, distilled water to achieve a final antibody concentration of 1 mg/mL. Gently shake it to solubilize the protein completely. Do not vortex.

Storage and Stability

Upon receipt, store immediately at -20°C for 24 months in lypholized state. -80°C for 12 months after reconstitution. Avoid repeated freeze-thaw cycles.