Farnesyltransferase, CAAX box, α (FNTA) forms a part of the heterodimeric CAAX farnesyltransferase complex that attaches a farnesyl moiety to a cysteine residue in proteins. The protein substrates usually comprise of nuclear lamins, retinal proteins and ras proteins.
Rabbit Anti-FNTA antibody recognizes canine, rat, human, and bovine FNTA.

Synthetic peptide directed towards the C terminal region of human FNTA

Rabbit Anti-FNTA antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.

Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein′s with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. FNTA is the alpha subunit of these transferases.Prenyltransferases attach either a farnesyl group or a geranylgeranyl group in thioether linkage to the cysteine residue of protein′s with a C-terminal CAAX box. CAAX geranylgeranyltransferase and CAAX farnesyltransferase are heterodimers that share the same alpha subunit but have different beta subunits. This gene encodes the alpha subunit of these transferases. Alternative splicing results in multiple transcript variants encoding different isoforms.

Synthetic peptide located within the following region: DNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNV

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.