Skip to Content
Merck
Sign Into View Organizational & Contract Pricing

About This Item

Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

recombinant

expressed in CHO cells

Quality Level

conjugate

unconjugated

antibody product type

primary antibodies

clone

recombinant monoclonal

form

lyophilized

species reactivity

macaque (Cynomolgus), human

concentration

1 mg/mL

technique(s)

ELISA: 0.0001-10 μg/mL

optimum pH

6.2

pH range

5.5-6.5

immunogen sequence

MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Protein ID accession no.

UniProt accession no.

storage temp.

-65 to -96°C

target post-translational modification

unmodified

Gene Information

human ... TNF(7124)

General description

Anti-TNFSF2 / TNFa Reference Antibody, expressed from CHO cells with a heavy chain type of huIgG1 and a light chain type of hukappa, has a predicted MW of 145.36 kDa. This antibody serves as a versatile tool for various research applications. It facilitates ELISA assays for quantifying TNFSF2 / TNFa expression levels, FACS for precise cell sorting, kinetic studies to analyze its binding properties, functional assays to assess its biological activity, and utilization in animal models to evaluate its efficacy and safety profiles in vivo. These applications provide comprehensive insights into its potential therapeutic applications, particularly in the treatment of inflammatory diseases and autoimmune disorders.

Immunogen

TNF-alpha

Packaging

100ug/vial; 1mg/vial

Reconstitution

For reconstitution, we recommend adding sterile, distilled water to achieve a final antibody concentration of 1 mg/mL. Gently shake it to solubilize the protein completely. Do not vortex.

Storage and Stability

Upon receipt, store immediately at -20°C for 24 months in lypholized state. -80°C for 12 months after reconstitution. Avoid repeated freeze-thaw cycles.

Not finding the right product?  

Try our Product Selector Tool.


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

It looks like we've run into a problem, but you can still download Certificates of Analysis from our Documents section.

If you need assistance, please contact Customer Support

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service