Skip to Content
MilliporeSigma
All Photos(2)

Key Documents

SAB1406659

Sigma-Aldrich

Anti-SPOP antibody produced in mouse

purified immunoglobulin, buffered aqueous solution

Synonym(s):

TEF2

Sign Into View Organizational & Contract Pricing

Select a Size


Select a Size

Change View

About This Item

UNSPSC Code:
12352203
NACRES:
NA.41

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

polyclonal

form

buffered aqueous solution

mol wt

antigen ~42.1 kDa

species reactivity

human

technique(s)

indirect immunofluorescence: suitable
western blot: 1 μg/mL

NCBI accession no.

General description

Speckle type BTB/POZ protein (SPOP) is encoded by the gene mapped to human chromosome 17q21.33. The encoded protein is characterized with a substrate-binding MATH (meprin and TRAF-C homology) domain at the N-terminal and a CUL3-binding BTB domain at the C-terminal end.
This gene encodes a protein that may modulate the transcriptional repression activities of death-associated protein 6 (DAXX), which interacts with histone deacetylase, core histones, and other histone-associated proteins. In mouse, the encoded protein binds to the putative leucine zipper domain of macroH2A1.2, a variant H2A histone that is enriched on inactivated X chromosomes. The BTB/POZ domain of this protein has been shown in other proteins to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes. Alternative splicing of this gene results in multiple transcript variants encoding the same protein. (provided by RefSeq)

Immunogen

SPOP (NP_001007227.1, 1 a.a. ~ 374 a.a) full-length human protein.

Sequence
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS

Application

Tissue microarray (TMA).

Biochem/physiol Actions

Peckle type BTB/POZ protein (SPOP) activates β-catenin/ transcription factor 4 (TCF-4) complex and stimulates tumor progression in clear cell renal cell carcinoma. The encoded protein ubiquitinates various substrates in Drosophila and human, including puckered (Puc), cubitus interruptus (Ci) / glioblastoma (Gli), macroH2A, death-associated protein 6 (DAXX) and steroid receptor coactivator (SRC)-3. It acts as a potential tumor suppressor for various cancers including breast cancer. Mutation in the gene is associated with the development of human prostate cancers.

Physical form

Solution in phosphate buffered saline, pH 7.4

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Destruction of Full-Length Androgen Receptor by Wild-Type SPOP, but Not Prostate-Cancer-Associated Mutants
An J, et al.
Cell Reports, 6(4), 657-669 (2014)
Tumor Suppressor Role for the SPOP Ubiquitin Ligase in Signal-Dependent Proteolysis of the Oncogenic Coactivator SRC-3/AIB1
Li C, et al.
Oncogene, 30(42), 4350-4350 (2011)
SPOP promotes tumor progression via activation of β-catenin/TCF4 complex in clear cell renal cell carcinoma.
Zhao W, et al.
International Journal of Oncology, 49(3), 1001-1008 (2016)
Serum Autoantibodies in Chronic Prostate Inflammation in Prostate Cancer Patients
Schlick B, et al.
PLoS ONE, 11(2), e0147739-e0147739 (2016)
Bettina Schlick et al.
PloS one, 11(2), e0147739-e0147739 (2016-02-11)
Chronic inflammation is frequently observed on histological analysis of malignant and non-malignant prostate specimens. It is a suspected supporting factor for prostate diseases and their progression and a main cause of false positive PSA tests in cancer screening. We hypothesized

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service