Skip to Content
Merck
Sign Into View Organizational & Contract Pricing

About This Item

UNSPSC Code:
23201100
NACRES:
NA.12
Technical Service
Need help? Our team of experienced scientists is here for you.
Let Us Assist

biological source

human

Quality Level

recombinant

expressed in HEK 293 cells

Assay

≥98% (SDS-PAGE)

form

lyophilized powder

potency

≥98% Heavy amino acids incorporation efficiency by MS

mol wt

calculated mol wt 17 kDa

technique(s)

mass spectrometry (MS): suitable

suitability

suitable for mass spectrometry (internal calibrator)

UniProt accession no.

storage temp.

−20°C

Gene Information

human ... IFNG(3458)

General description

Interferon gamma (IFNγ) is a dimerized soluble cytokine that is the only member of the type II class of interferons. IFNγ is secreted by T helper cells (specifically, Th1 cells), cytotoxic T cells (TC cells) and Natural killer (NK) cells. When combined with other inflammatory cytokines, evaluating the levels of IFNγ can be used as a diagnostic tool in patients with breast cancer or benign prostatic hyperplasia. A recent study evaluated the effect of a cancer vaccine given to patients with colorectal cancer, on the levels of plasma pro-inflammatory cytokines (including IFN-γ). The study concluded that patients achieving stable disease showed increasing levels of plasma inflammatory cytokines.

Immunogen

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG

Biochem/physiol Actions

SILuLite IFNG is a recombinant human protein expressed in human 293 cells. It is a homodimer consisting of 138 amino acids Expressed in human 293 cells, with a calculated molecular mass of 17 kDa. SILu Lite IFNG is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Physical form

Lyophilized from a solution of phosphate buffered saline.

Legal Information

SILu is a trademark of Sigma-Aldrich Co. LLC

Storage Class Code

11 - Combustible Solids

WGK

WGK 2

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable


Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service