Skip to Content
MilliporeSigma
All Photos(3)

Key Documents

HPA015138

Sigma-Aldrich

Anti-SLC41A1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonym(s):

Anti-Solute carrier family 41 member 1

Sign Into View Organizational & Contract Pricing


About This Item

UNSPSC Code:
12352203
Human Protein Atlas Number:
NACRES:
NA.41

Pricing and availability is not currently available.

biological source

rabbit

conjugate

unconjugated

antibody form

affinity isolated antibody

antibody product type

primary antibodies

clone

polyclonal

product line

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

species reactivity

human

technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:50-1:200

immunogen sequence

QASRISTFLHMNGMPGENSEQAPRRCPSPCTTFFSPDVNSRSAR

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item
SAB2102214HPA021987HPA078818
biological source

rabbit

biological source

rabbit

biological source

rabbit

biological source

rabbit

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

antibody form

affinity isolated antibody

Quality Level

100

Quality Level

100

Quality Level

100

Quality Level

100

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

-

product line

Prestige Antibodies® Powered by Atlas Antibodies

product line

Prestige Antibodies® Powered by Atlas Antibodies

technique(s)

immunoblotting: 0.04-0.4 μg/mL, immunohistochemistry: 1:50-1:200

technique(s)

western blot: suitable

technique(s)

immunohistochemistry: 1:50- 1:200

technique(s)

immunofluorescence: 0.25-2 μg/mL (ICC-IF), immunohistochemistry: 1:200 - 1:500

General description

SLC41A1 (solute carrier family 41, member 1) is a cytoplasmic integral membrane protein, and has either ten or eleven transmembrane domains. The N-terminal faces the cytoplasm. This gene is located on human chromosome 1q31-32, and codes for a protein composed of 513 amino acids, and a molecular weight of 56kDa. It has a wide range of tissue expression, and is found in heart, thyroid gland, muscle, testis, and kidney.

Immunogen

Solute carrier family 41 member 1 recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Biochem/physiol Actions

SLC41A1 (solute carrier family 41, member 1) is a Mg2+ transporter, and exchanges extracellular Na+ for intracellular Mg2+ ions (NME, Na+/Mg2+ exchanger). This process is basic for multiple cellular activities such as maintenance of cell pH, ion concentration, volume, production of cellular energy etc. A gain-of-function mutation, p.A350V, in this gene is linked to Parkinson′s disease. It is up-regulated in preeclamptic placentas, and thus, Mg2+ homeostasis might play a role in preeclampsia development. Mutation in this gene results in a phenotype very similar to nephronophthisis.

Features and Benefits

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Linkage

Corresponding Antigen APREST72512

Physical form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Legal Information

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Not finding the right product?  

Try our Product Selector Tool.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point(F)

Not applicable

Flash Point(C)

Not applicable

Personal Protective Equipment

dust mask type N95 (US), Eyeshields, Gloves

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Martin Kolisek et al.
Hypertension in pregnancy, 32(4), 378-389 (2013-07-13)
To examine expression profile of magnesium responsive genes (MRGs) in placentas of normoevolutive and preeclamptic women. The expression profiles of MRGs were determined in placentas of normoevolutive (N=26) and preeclamptic (N=25) women by RT-qPCR. Among all tested MRGs (9) only
Martin Kolisek et al.
PloS one, 8(8), e71096-e71096 (2013-08-27)
Parkinson's disease (PD) is a complex multifactorial ailment predetermined by the interplay of various environmental and genetic factors. Systemic and intracellular magnesium (Mg) deficiency has long been suspected to contribute to the development and progress of PD and other neurodegenerative
Toby W Hurd et al.
Journal of the American Society of Nephrology : JASN, 24(6), 967-977 (2013-05-11)
Nephronophthisis (NPHP)-related ciliopathies are recessive, single-gene disorders that collectively make up the most common genetic cause of CKD in the first three decades of life. Mutations in 1 of the 15 known NPHP genes explain less than half of all

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service